GenomeNet

>lru:HMPREF0538_21209 K01126 glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46] | (GenBank) glycerophosphodiester phosphodiesterase family protein (A)
MKNAYRAFRQYSCQFRKNWLEYLILFGGLDILNQFLVIPFFRWITTFVLQAGEIPFISYQ
NIVIILTHHPLVVVILLIELICLMVIIYGEFMLLLKGFCGIGLPEFSWRRMFRQTKETLS
LLNFGSLILLLGYFLLIIPFADIIFRTPLLAKIQVPQFIVDYLTRNAWLIGGLTLFYLLM
TMIGIRLILTMPLMAYQHLRLRAAMSQSWQMTSKLRWLKFLIQIVLMTIIVGSITVVFYL
MIYILQVVLDLLPGKLSLITAIFNLSILQLGGEVLAVWAGTIILLVVVNPLTSISELATT
PEHPSRGLLTSFMLVFLVIGLATLANNTFYMMGTGIKRPITISHRGVTEKNGVQNTIPAM
EKTSKLKPDYIEMDLHETKDHQFVVMHDENLKDLTGVNKTPHELTLKQLTRLTARENGYH
AKVASFDQYLAAAEKYHQKLLIEIKTTPHDSKQMLQNFNRRYGKRILQDHDQVHSLDYSA
VTKLKNINPRLTVLYIQPYNLGNPQGVADGFSMEYSTLNQDFITQAQWQHKPVYAWTVND
TDLMKQTMYNHANGIITDNLGELNAAIKDFTGKQSYANRILNYIIVVPTSGGIEP

BLAST