GenomeNet

>lsg:lse_0281 type I restriction-modification system, R subunit; K01153 type I restriction enzyme, R subunit [EC:3.1.21.3] (A)
MGNTIKKASEKAFQENFVKELQNYKWDAPDFLDGNKQKVTVNDLINHWRGELNRLNADQL
EGVPLTDGEFKQVMSKVNKIKNSYDAAKLLAIEEGKGKIDGIYRDDNPKVTRKQITLTIF
KKAEVRGGESSYKIAREVEAPMTDEKDKTNRFDIVLLINGLPLINVEQKRADKPLDEAFE
QFKRYYRNGEYTNNFMAFSQMMVMTTEIETRYFATPKSIKDFNQSFVFHWSDKNNKPMNN
WKQIVANFLMIPMAHQMVGDYLIIDEAKEQENKRHMLMRPYQVYALQAVEGAAFGWDQED
KIPHGGFVWHTTGSGKTITSFKTALFLSTRAGFDKVVFLVDRRELDNRTSANFKSYATFE
SVSVDDTEHTYHLKKELKSSKAGIIVSTTFKLNSLVKELEESHDNSLADKKIVFIIDEAH
RTTMGQMMGNIKKYFKKKGLFYGFTGTPLFDENEVKGKVNDKSELINTTEKLFGKKLHNY
TIDEAIADGNVLGFNVDYINTGEFENYDALRDKLIERMLLEKPESGVKETTRLVCEYSEL
EVEKEAVKIGLLAYHDDTHIPRVVEEILANWETQSQAQTFNAILTVAYKKRVIAYYNEFK
KQQQSSDKKINIAMTFSFGSENDPDNVAPETIEKMFSDYAEFTGINLVAGDKKHGEAAYF
EDVVERATRGGSGRNEKNIDLIIVADQLLTGYDSKYLNTLYVDRHLKRQSLIQAYSRTNR
VLDKRKEFGSVVNFQYPRMTEEEVNKALKLYGNGGKSSLAIVDIYDTAVKKLRIKINKMI
LTLPDPTAWATLENDEIGKKEFFEAFRDAAIQWRKVEQYYEYVWKAGTFGTDEHTWLLYM
GAYNNLMKEDQIPHEESISEPLPGKTRLSRNQKIDAAHILSLIDSKVDSSGTTQFADKET
LRLIYEDIQELSNRGEHNQAMLLKDFVEQELVPGKITSDITFDDAFEAWKREQEQVVIHA
FAKEWGIIDQGDLLAKSVMAYSEMQPEVIPYFEDLIGSVEYEIAENKVAGNQLEHKMKLR
EKMPEWIAETRQRYN

BLAST