GenomeNet

>lsg:lse_2445 hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVVIFTSGIDDRDQVGFISSRIGLKREAT
PIFSDTNIYEIVADITPKPSCVLLDESQFLEKEHVFQLAKIVDDLNIPVIAYGLKNDFRN
ELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPV
CRKCHAHPPIK

BLAST