GenomeNet

>lsg:lse_2445 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) unnamed protein product (EC:2.7.1.21) (A)
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVVIFTSGIDDRDQVGFISSRIGLKREAT
PIFSDTNIYEIVADITPKPSCVLLDESQFLEKEHVFQLAKIVDDLNIPVIAYGLKNDFRN
ELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPV
CRKCHAHPPIK

BLAST