GenomeNet

>lsp:Bsph_p130 putative DNA ligase-like protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MLVATGIEIINTEDWLYQVKWDGWRVLIHKAGDRIEAFTREGNNITAKFPELEEVGHSIT
VDTAIIDTEGVVLRQGISVFEDFSYRGILTNKEKIKEATITHPVTFVAFDILTTDKKLMH
HPLFERKEHLSSIITPSNSLQVTPSVDGDGSNIFEITKDKGMEGIIGKKRDSIYQLNHRS
KNWLKYKHFKIIETVILAYRENPFSILVGTELESGRYKRLATVEFGFKPEEKMAFRHIAK
SVITTVDRDLIWLEPRLYCKVQYLEKTNSGLLRTVSFKGFIF

BLAST