GenomeNet

>lth:KLTH0G07480g KLTH0G07480p; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLSVRQMKLSTSRRLFSRTSRALRAFAANGDVDGQNSAPFGGQYQVVDHEYDCLVVGAGG
AGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDNWKWHMYDTVKGSD
WLGDQDSIHYMTREAADSIIELEHFGVPFSRTEEGRIYQRAFGGQTKENGKGGQAYRTCA
VADRTGHALLHTLYGQALRHNTHFFIEYFALDLLVHNGEVVGVIAYNQEDGTIHRFRAHK
TVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGA
RGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIREGRGVGPEKDHMYLQLNHL
PASVLKERLPGISETAAIFAGVDVTKEPIPILPTVHYNMGGIPTKWTGEALTVDEEGNDQ
VIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADTLQPGLPHKPLPSDLGK
ESIANLDKLRNATGSKPTSQIRLAMQKAMQADVSVFRTQESLDEGVRNVGAIDESFEDVG
TTDRSMIWNSDMVETLELQNLLSNARQTAVSAANRKESRGAHAREDYPERDDKEWMKHTL
SWQKHPQGNVELGYRSVIATTLDESECPPVLPTVRAY

BLAST