GenomeNet

>lth:KLTH0H08316g KLTH0H08316p; K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MGKKIVFNISSEFQLQQMLGEGAYGVVCSARHLPTGQMVAIKKIEPFDRPLFCLRTLREI
KLLRCFQHENIISIFDIQRPASFETFSEVYIIQELMDTDLHRVITTQTLSDDHVQYFVYQ
ILRALKCLHGAEVIHRDLKPSNLLVNANCDLKLCDFGLARCAGGGTKPGDAGHMTEYVAT
RWYRAPEVMLTAAEYTFAMDVWSCGCILAELLMRRPLFPGKDYHHQLLLIFQVIGSPTAG
DLGCVRSKRARQYLNTLPRYAGDGNLRSLVPDASAEALDLLEQMLVFDPRRRITASQALK
HPYLQAYHDPQDEPATAKVDPALFHFDERKDKLGAGDLKRLLWDEIFGKRERTDS

BLAST