GenomeNet

>lth:KLTH0H08316g K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] | (RefSeq) KLTH0H08316p (A)
MGKKIVFNISSEFQLQQMLGEGAYGVVCSARHLPTGQMVAIKKIEPFDRPLFCLRTLREI
KLLRCFQHENIISIFDIQRPASFETFSEVYIIQELMDTDLHRVITTQTLSDDHVQYFVYQ
ILRALKCLHGAEVIHRDLKPSNLLVNANCDLKLCDFGLARCAGGGTKPGDAGHMTEYVAT
RWYRAPEVMLTAAEYTFAMDVWSCGCILAELLMRRPLFPGKDYHHQLLLIFQVIGSPTAG
DLGCVRSKRARQYLNTLPRYAGDGNLRSLVPDASAEALDLLEQMLVFDPRRRITASQALK
HPYLQAYHDPQDEPATAKVDPALFHFDERKDKLGAGDLKRLLWDEIFGKRERTDS

BLAST