GenomeNet

>mac:MA3428 hypothetical protein (A)
MLEEYAKKRDFKKTSEPPANGVEKSSDKSSDEPVFVVQRHDATNLHYDFRLELGGVLKSW
AVPKEPPESAGIKRLAIQTEDHPLEYADFEGEIPEGEYGAGKVEIWDKGSFELQKHNEKE
IAVTLHGEKLEGDYVLIRTKYGKEGKGWLFFRKKTD

BLAST