GenomeNet

>mai:MICA_1242 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) hypothetical protein (A)
MNNQIDTPIQDKSYTRRMERLLTRRYMGIVATQDPDSFALIARRKDIQQGENKTTRMKEY
VALWQGLSADQQLKLAEHDAKINHLARLARTLATTTVVQAHNKIKTTTAGSIDFVMRRFR
EEGVAPEQVQQFLDDNAVAWFSITGHPTNPTTVDYTIAQTDVARVIVDPSATPDDLHDAL
LHLYQTPIVGDRKTPLDEARESINTLNSIYDVALAHRDLFIKAIADHGYADQGVNITRAL
IVPCSWTLGDADGNPALTAQVLADGIALHRQAIADRYQLTLQSIHTDHQPTMLALHTLQK
ILAQAGPQTQIDSVCQKIQSIIADCPDEAAQKQIQDFRYLLHCFGFGFGTIDIRHNAVDI
LAAVKKLAVLCGLENKQDMDAIGLDHIQLKLAAWLRDDAVLSRMASATDLPDDESAMIVG
RLRVIGQNPDMCEKLIIAETTHPAHALAALLLLKITGNVVADDGARIDLTMLSESVHDLM
NLGNTLETLLDNETFRAHVAARGRLLVMIAKSDTTRQDGRGEAEYAQYEAAIDIYRVAEK
MRRKYRDLRHVLPSIMNGGGHALQRGGGRVTEIPAVHGRAAADARATDIGPSTLTVQGHQ
QNVLFCPGPVAVGTMEALAAQNLYSKAGIYGEMPDPVSRPGLNRHHGQYDAWLYAQTAGR
AFDTLTQKNVAIDELLVRAPWLAMKAGNASSRPAKRGEKMVGPGITPREAIGVDPRALQG
RAISGERLTAHACLPIFSVLGLVEAMISVRDHGRASRNPEKYGDGLHHLYRAHKIHRDGA
RATLNASIMADFDIAWPLLVGDERPPRTIVEKLAAQFLHHDPDHNNTPAITLAFLEQYFL
NVERLSYEMVSGQKAKKNFNHGDGLRILWPELFHEMSIRNRAAEFSRVIECYRTVQMDRA
PDIPLDETQFRITQNLYAAADVVNAPIGILATRTRLEPVYDLRGGVKTRFMKPESYLESD
VAGLLSLPPALS

BLAST