GenomeNet

>mal:MAGa2710 type II restriction endonuclease; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MSNKIDYFVETLLPTNKNYAYFVNWQNVKLPEQLEVEFNALNSLISKTNNFDDSFIALLS
KLPSVVQTFPFLLALSKQDREHLVNRHTKLEIFDNENQVVNDIEFFVAQDKLSFDEIEKY
LNFFKKTGLKNLFTDILKRNVIDYLTGTLVGLDTHGRKNRSGQNFQVLCENLIISIALKY
NLTFYKQVRFKDIENDNLKFTDGLHNKIADIVLVKNGKALNIELNYFETGGSKPNEIIES
YINRKNELRKTGNYFILISDGLVWKQNSHNQLIKAFDNIEIVNYHVAKSSEFEERIKQIF
DVSESVTKE

BLAST