GenomeNet

>mal:MAGa2710 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) Type II restriction endonuclease (A)
MSNKIDYFVETLLPTNKNYAYFVNWQNVKLPEQLEVEFNALNSLISKTNNFDDSFIALLS
KLPSVVQTFPFLLALSKQDREHLVNRHTKLEIFDNENQVVNDIEFFVAQDKLSFDEIEKY
LNFFKKTGLKNLFTDILKRNVIDYLTGTLVGLDTHGRKNRSGQNFQVLCENLIISIALKY
NLTFYKQVRFKDIENDNLKFTDGLHNKIADIVLVKNGKALNIELNYFETGGSKPNEIIES
YINRKNELRKTGNYFILISDGLVWKQNSHNQLIKAFDNIEIVNYHVAKSSEFEERIKQIF
DVSESVTKE

BLAST