GenomeNet

>maq:Maqu_0002 DNA polymerase III subunit beta (EC:2.7.7.7); K02338 DNA polymerase III subunit beta [EC:2.7.7.7] (A)
MKLTISRESLITPLQSIAGVVEKKQTMPVLSNVLLEAEDNTLTLTGTNMEVELVARVAPV
HVDQPGRITVPARKLADICRALGDEAPIDLALEGDRLHLRSGNSHFTLSTLPAEHFPNVE
DEPESFRLALPQKELGRMLDATAFAMAQQDVRYYLNGLLLEVDVNHARVVATDGHRLAMA
QLDLDTGCPELRQVIVPRKGVLELARLLDDEESPVTLVIGDNHLRATVGSYTFTSKLIEG
KFPDYNRVIPRGGDKTVLADRSTLKSTLQRAGILSHENIRGVRLNLSPNQLQVFANNPDQ
EQAEDALPVEYQGESLQIGFNVGYLVDVMNALDDDQVKITLSNPNSSALIEAQNDNRCLY
VVMPMRL

BLAST