GenomeNet

>maq:Maqu_0002 K02338 DNA polymerase III subunit beta [EC:2.7.7.7] | (GenBank) DNA polymerase III, beta subunit (A)
MKLTISRESLITPLQSIAGVVEKKQTMPVLSNVLLEAEDNTLTLTGTNMEVELVARVAPV
HVDQPGRITVPARKLADICRALGDEAPIDLALEGDRLHLRSGNSHFTLSTLPAEHFPNVE
DEPESFRLALPQKELGRMLDATAFAMAQQDVRYYLNGLLLEVDVNHARVVATDGHRLAMA
QLDLDTGCPELRQVIVPRKGVLELARLLDDEESPVTLVIGDNHLRATVGSYTFTSKLIEG
KFPDYNRVIPRGGDKTVLADRSTLKSTLQRAGILSHENIRGVRLNLSPNQLQVFANNPDQ
EQAEDALPVEYQGESLQIGFNVGYLVDVMNALDDDQVKITLSNPNSSALIEAQNDNRCLY
VVMPMRL

BLAST