GenomeNet

>mat:MARTH_orf165 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MYKNFNEGMIEVITGPMFSGKSEELLKRIRTLEYAKLKPLVIKPEFDTRFSENEIVSRAG
VKHKTHILKNINDVYFLLQEDKYKAVVIDEAHWFNEELVKVADDLANKGYLVIVAGLDQN
YLREPFGPIPNLLAIAERVTKLQAICVKCQHAASTSFRKVAASEINLLGDFQEYEARCRK
CHNAGQKEKLQKKV

BLAST