GenomeNet

>mat:MARTH_orf165 tdk; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MYKNFNEGMIEVITGPMFSGKSEELLKRIRTLEYAKLKPLVIKPEFDTRFSENEIVSRAG
VKHKTHILKNINDVYFLLQEDKYKAVVIDEAHWFNEELVKVADDLANKGYLVIVAGLDQN
YLREPFGPIPNLLAIAERVTKLQAICVKCQHAASTSFRKVAASEINLLGDFQEYEARCRK
CHNAGQKEKLQKKV

BLAST