GenomeNet

>mau:Micau_0485 DNA polymerase LigD polymerase subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPSERLKVEVEGRSLELSNLDKVLFPKAGFTKGEVIDYYTRIAPVLLPHLRDRALTRIRF
PNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVCDELPTLVWLANLAALE
LHTPQWKIGAHPDMMVVDLDPGAPAALKQCCRVALLMRDRLADDGISSFPKTSGKKGMQL
CCPIAGTQDAEVVSDYAKRIAQELEQAHPKLVVSKMAKNLRPGKIFIDWSQNNAAKTTVA
PYSLRAQSVPSVSTPLTWDEVEAGAAGKRPSTRPYTAGEVLKRVEKQGDLLAPLLDGGPE
LP

BLAST