GenomeNet

>mau:Micau_1144 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase D, 3'-phosphoesterase domain protein (A)
MADRLEEYRRKRDAARTPEPVPERAPGRKRSARRAPRFVIQQHHARSLHWDLRLEHDGVL
ASWAVPRGLPRDPGRNHLAVHTEDHPMEYLTFHGEIPAGEYGGGRMIVHDTGTYRAEKWR
DDEVIVVLDGERTKGRYVLFATGGRGRDWMIRRTDPAPEGWTPMPELVRPMLPAEGGRLP
RDAAAWGYELRWAGVRAMAYVSGGRLRLLDGDDTEVTGDYPWTRAMAEALAPAEAVIDGV
LVRIDPAGRVRPPTRRDGQFLAVDLLWLEGVSSLDVPYAQRRDLLDGLALTGPHWQTPPW
FPGVGADALRAAREQGLPGVVAKRLDSPYEPGRRSRHWLSIDAS

BLAST