GenomeNet

>mau:Micau_2667 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) hypothetical protein (A)
MSPRRAIPRRATVLAAAALTLLSVLPATAAQAAAPAGVTATVGADCTAGRLLLDLDNRSA
TTQTYTVTWPGRTGSPWTRTVAAGGSAELYWTLSPGTPYTLRTTTPTGLDDTTSGIFHCG
TGMSALAGFDCTNGRLQLALENRTTTARDFTVTWPGRTGSPWTRTVAAGGNYLHYWTVGA
GTPYTLRITAPGFDTTLRGTTSCDLAAGNPQLATTTLLTTQTVIRDLNGAGGRYDGTVAS
VRIPGLAVTNNGTVVAVADARVNGSYDLGGGTNNIQIVMIRSTDGGRTFEQPRVIHAPPT
TSEGVGDPSLLVDRATGVVYCFFTYSPRPGISFWSGGSGLNTADDPNSMHLRYITSRDNG
ATWSAPVELNPAVKDPTWRQVFFSSGHGIQTSTGRLIQPIAYRDSAGTSHAANIYSDDHG
VTWRRGGSAGGNINESKAIERGTGAVVQNMRHNSTRSRFYATSADGGATFGTATASALLP
DPLCNADEMSYLRPAEVGANRAPVRTRTALFSNNAHPTARNDLTVRLSTDDGATWPARAL
VKPGGAGYSTMAVLADGTVGNLYEVGNTGGIYFARFSLDWVKGA

BLAST