GenomeNet

>mau:Micau_3448 DNA primase small subunit (A)
MTVATTAAQEIQVGERLVRVSSPDKPYFPERGLTKLDVISYFLSVGDGILRALRDRPTML
ERWPRGVFEGAKVATRQTNKGDAFYQKRLPAGAPDWVRTAHITFPSGRTADEVAPSELAV
VIWAANLGTLRFHPWPVSKDDVEHPDQLRIDLDPMPGVDFAQVVPVAHEVRAYLTELGLE
GFPKTTGGRGIHVYVSIEPRWSFGECRRAVLALGREMQRRLPDLVTTTWWRDQRDRPVFV
DYNQMARDHTMTSAYSIRPTPAALVSAPLEWSELDDARPEDFDVLSMPERFAELGDPHAG
LDGRRYSLEPLLERADAEGLESPPER

BLAST