GenomeNet

>mau:Micau_4189 group 1 glycosyl transferase protein; K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MGGDPTRHRGDAAGVGTPQLKGGRVSADAEVIDIQPARRLRLLLLSWEYPPVLVGGLGRH
VHALSVALAAAGHEVTVVTRHAEGAPLEEYADGVRVVRAAEDPVRFPLATDSLLAWTMAF
NHTLTRAALRAASSGTYDVIHAHDWLVAHTAVTLAEHLDVPLVTTIHATEAGRHQGWLPE
EMNRTIHGVEHWLSNASGRVIACSGYMRDQVARLFGVPAGRIDVVANGVDDRAWRARPHA
VASARARFAAGGPLVGYAGRLVYEKGVQHLVHAVPHLAKRHPGLRVVIAGDGPYRDELVD
QARRLHVGDTVRFAGFMDATQLPAVLAATDATVIPSLYEPFGMIALEAAAAGAPLAVART
GGLAEIVEPGVTGVTFPHGDPDALAGAVDRLLGDEVFARRVARKARSMVSRRYTWSAIAA
RTAAAYATARRDHDAFQTRRATALLAGDRSPIAVPEGNLLAGAAS

BLAST