GenomeNet

>mau:Micau_5621 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) ROK family protein (A)
MVTTLAIDCGGGGIKASVLDAAGTMRARPLRVPTPYPLPPGLFVKTLLDLGARLPTADRL
TVGMPGMIRHGVVVATPHYVTRSGPRSRVDPELLAEWSGYDARTALAGAFGVPALVLNDA
EVHGAGVVAGTGCELVLTLGTGLGSALFDGGVLAPHLELSHAPVRWNTTYDTYVGEPERR
RLGDAFWSRRIRQVVDGLRPVFRWDRLYLGGGNSRLIRPEQVARMGDDVVIVPNTAGIVG
GVRAWDLIGGRYDPTT

BLAST