GenomeNet

>mav:MAV_0362 ligD; DNA polymerase LigD, polymerase domain (A)
MAAAEEVDVDGIAVRLTNPDKVYFPKLGSKGTKRHLIDYYRAVAGGPMLDALRDRPTHLQ
RFPDGIDGEEIYQKRIPQHHPDYLQTCRVTFPSGRTADALKVTHPAAIVWAAQMGTVTLH
PWQVRCPETDHPDELRIDLDPQPGVAFAQARSVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDQLAGADPDDYTMATVPDLVSARENPWAAIDDVAQSIGPLL
RMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTEHKKKN

BLAST