GenomeNet

>mav:MAV_0362 ligD; DNA polymerase LigD polymerase subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAAAEEVDVDGIAVRLTNPDKVYFPKLGSKGTKRHLIDYYRAVAGGPMLDALRDRPTHLQ
RFPDGIDGEEIYQKRIPQHHPDYLQTCRVTFPSGRTADALKVTHPAAIVWAAQMGTVTLH
PWQVRCPETDHPDELRIDLDPQPGVAFAQARSVAVDVLRPLLDELGLVGYPKTSGGRGIH
VFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMA
SAYSVRRTPIATVSMPLTWDQLAGADPDDYTMATVPDLVSARENPWAAIDDVAQSIGPLL
RMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTEHKKKN

BLAST