GenomeNet

>mav:MAV_3148 no KO assigned | (GenBank) ligD; DNA polymerase LigD, ligase domain (A)
MTDFAALPDSVRAALRDEPVPQWCSPTLATLTEQRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRKPLNGTYPELVEALAAQRETRFVLDGEVVAFEGRRTSFARLQGRLGITDPDV
ARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKAIDFTDPLRYAPHRVGDGMAAYR
AACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEFVVGGYTSPKGKRLELGALLLGY
YQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPFTRSLVPEAGAHWVRPELVVQIG
FTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR

BLAST