GenomeNet

>mav:MAV_3879 glycosyl transferase, group 1 family protein (EC:2.4.1.-); K16150 glycogen(starch) synthase [EC:2.4.1.11] (A)
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRTHPSTDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLHDKKPGGNRPWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSA
SMADEITELFGPGLAQITVIRNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRIRRTHPGTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVPALAAAIRTVL
DDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRAERQPQARLPIVEHALPDR

BLAST