GenomeNet

>mav:MAV_4265 aldehyde dehydrogenase (NAD) family protein (EC:1.2.1.-); K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MTLPTADELRARAADALRSLGAHVELGAPDAHGLPASTPITGEVLFTVAPTTPDQAEHAI
TQAAQAFSEWRRTPAPVRGALVARLGELLRAHRDELAALVTLEVGKITSEAAGEVQEMID
ICQFAVGLSRQLYGRTIASERPGHRLSETWHPLGVVGVITAFNFPVAVWAWNAALALVCG
DTVVWKPSELTPLTALATQALIARAAADVGAPPGVSAVVLGDRELGELLVDDERVALVSA
TGSVRMGRAVGPRVAARFGRVLLELGGNNAAVVTPSADLDLAVRAVVFAAAGTAGQRCTT
LRRLIVHHSVADEVVARVVSALRRLPIGDPFEPGTLVGPLIHETAYRDMVGALESARADG
GEVIDGDRRHPFAVEHPSSYYVAPAVVRMPAQTPIVATETFAPILYVLTYDRLDDAIALN
NAVPQGLSSAIFTTDLREAERFLDESDCGIANVNIGTSGAEIGGAFGGEKQTGGGRESGS
DSWKAYMRQSTNTVNYSGALPLAQGVEFG

BLAST