GenomeNet

>mba:Mbar_A0970 hypothetical protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MSREGNEEIDPQFIARLASFLGFNKERVQHLFEKNYLAQNWGKYEYLFRFDKEISHIERG
TVLYEKDGSFEIIMGFPKIRRAMVLDPTIKKHFNGLEKVAVEEKMNGYNVRIAIAKDEIL
AITRSGYICPYTTQKAKEKLNLKFFDDFPELVLYGEMIGPDNPYVPKDIYDIESVEFYIF
DIREKNSGKPLPIKRKHEILEKYGFFQVKFFKEIPLETAAEEIGKIIRELGEKEHEGVVI
KDPEMVLSPLKYTSSQSNCSDLRHAFKFYNETGRDYMLSRIVREGFQTVEWNEDKDEFEK
RCMQLGKSILGPLSESILSVKNGQRLYEEAKIRVRDLKTAAEFEDYLKRLGIDAIFEEPQ
LVGGEYLVIIKKINKSTNDKTQAIWQGEPW

BLAST