GenomeNet

>mbo:Mb3757c hypothetical protein (A)
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK

BLAST