GenomeNet

>mbr:MONBRDRAFT_15424 hypothetical protein; K11404 histone deacetylase 3 [EC:3.5.1.98] (A)
MSRPRVAYFFDADVGNFHYGPGHPMKPHRLALTHSLVLEYGLWSKMEIFRPYRASPEDMG
RFHATDYINFLQRVTPDNYRTFGSYLQRFNVGDDCPVFDGIFDFCSIYAGASIEGAVKLN
NKQCDVAINWSGGLHHAKKFEASGFCYVNDIVLAILELLKQHPRVLYIDIDIHHGDGVEE
AFYTTDRVMTVSFHKYGGHFFPGTGVMYELGAGRGRYYALNVPLKDGIDDMGYNELFKPV
MREVISKFQPSAIVLQCGADSLGCDRLGCFNLSIAGHGNCVEFIKSFNLPLLVLGGGGYT
IRNVARCWTHETGILLDEHLSEDLPYNDYFQYFGPDFKLHPNVATSVENQNSKEYLDKLR
EHVFEQLGQLDGAPSVMMQEVCALDECLGRRMSRKLGSS

BLAST