GenomeNet

>mbr:MONBRDRAFT_26994 hypothetical protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MAAAEITEAAAARASEAGAGSDAVQDELQQLREQHKKAVHYTANDWIEYEQIEAPIYKAK
MHKLEEDMECECQPNAADEDSYCGSNCLNRLLMVECNVARCPCGNKCRNRRLQKQQHARV
EIFKTEKKGWGLRALEPIRKGDFIYEYCGEVFDQAVFRERQLEYAQEGRFHYYFMSLSAD
TVIDATRKGAVSRFINHSCDPNAETQKWTVGGVLRIGFFCIRDIAVNEEITFDYQYERYG
RRDSGATEASSAKGRDRELNKLRDRLRPLLAPDGGLRNSFESTLSFMREMIHWRSDEVKG
RDIFLDILTDTTDDDVLVGLMTKKILVVLHSWLSDMFDEHVNLQRKTLKILLRLPIKTKV
AIRKVEPTLQCLTNSVDEVSQDLAKELLRAERSEVYIMNGQSAEQKNLREVVAVPTRHMT
TFHSAIVRDIAYQHHVKVEQLPSTTVNGQDLIITGDDAMSVSSAAQQLRGLLEQAVRNLE
ELESQRRARAEIRNSPQAREAQSRLPGTPGASSLSMVAAASEPPKPSNLPVKFVDKHLPE
FSSMSLHPDWDSVYSEQHNESYYFNRFTNETNWLRPVVQPLADRIQRRDNKRKLPGAAAL
GMDVDAKPTLSQVLAEGQQSKPKRVATEESKRKARLNKFKSEVSERVIKQLNAYREKKVK
YGYIRTSEDFKYLARKLTHKIVEKELQRRGQDVNELVMTDGLKGKASTRMHIKNFITDTM
KKCGKVFRQPAAPI

BLAST