GenomeNet

>mbr:MONBRDRAFT_30554 hypothetical protein; K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MDQVVRGSEAGKGDDGNAVTQPMPTPAPYTSVDEVMLPARLQGRNNVYSGCSCTGPCAPE
TCSCLCNGRARYYECNDNCACDVATCRAGRTTQQPTALDIRLVWTSERGHGLLTGTRIPV
GTYVGHYTGQLVNVATARARDSAADAVSPVHTYLLVLREHTQRGVLTTAVDAKEYGNLTR
FINHSCAPNLELRPVRLGFVPRLAFFALTDIPAETELTFDYGGAPPSAKIATTLPADTDT
GAPRHKRHVTAPELALSAKPCRCGAPTCRGFLPLTIW

BLAST