GenomeNet

>mbr:MONBRDRAFT_33094 hypothetical protein; K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] (A)
MGRRRRCVLVLLLARAAQEVAAVARAGVLVWVQHASFPWWPGMLTYDPHSGEFTRESANH
RAYHIQDGGLDPTLLKVGRLSPKLANERAAALQQAHAVAELSLRERILRWACDFKTERGD
KAKPKLEESDKDQATAPGTVSAPPRKIGVPRSKTAYQFYLDHRRADVMHNLDDDGTSKFA
RNGKVTKLIAAEWQTLTADERLPFDKQAEKAKKQAISKAQEMRAELEKSEPVTPERTASL
KPAVPRTKTAYMFYLDHRRADVMKGMDDDGTSKFARNGRVTKLIAAEWKALSEEARAPFV
EAAEIAKKTAIARTLELAQADASCPDSPGDRPPPMVAAFRLFAQDFLAKAQDSGDELVHL
DSADQGLRVHEKWMALTRTQQRAFVRRVQPDALPNKSGASTAAASPSASVSPDEDQASNE
GQPAAKRSRSSRTTMTANDDTCRICGELGQLICCDGGCRGAFHLECLSILQPPTGEFRCD
ECSTGNHTCYTCDKVGADLIKCQFPHCNKLYHRGCAEKQFKADNFCLVCGTGGDLVVCDG
CPGAYHAACIKSTFAFTGKPDEQGQWFCHDCLTGTKSMIHDVVWAKYGSYRWWPAVILSA
TEYPERCGQSPAEGNFLVKFLGSNDVAWVGHESIIPFSNGDQKNSYFTRNLKAAKKSFQE
AVTLALDLFTERKQEREDQLAAIRGKIIERPPRFKLIKRNVYLPPAAKPPHRKEEQEICR
CDAALNCADMHSCLNRMMYIECDAKCCNNGKNCRNQRFQRREYPKLIPFKTEHRGWGLRL
GQDVEEGDLVIEYVGEVIDGAECRRRIDQYEERNTSSFYILSLGSDTFVDAREKANMARF
INHSCDPNCVTQKWNVLGETRVGIFAKRALAKGTELTFDYMLDCLNSVKKTPCHCGAPNC
SGFIGVKPNRSGTTYEDLDRTDDECFICKDGGDLLMCDKKNCDKVYHLACLGMNKVPAGK
FICPHHACLKCGRKATIFSETGPEAYCSMKHIATPEVRALCEGKRPPVTFKSPVPVLPAV
FANGTWAKRAKRAKADPTSTTQAQAASA

BLAST