GenomeNet

>mbr:MONBRDRAFT_34214 hypothetical protein; K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] (A)
MAASAEAEVSQSKPSPLKDQAGPVQPRPAGLTPGNPVQAVVEEAASPCASSPQAPSSAPN
SHRRPVGGRIGRVHLGQPGRRVPDEEDVEAIPGGSRELGITEDWFDVPPLFPPVDTTQTH
LAILSPNPKGPPMLYQWPFTHMTDSSYDAGFELLNSMNHIVKLCALPVPDTWADDIVACA
KPGTEFASLSKVVEAFNAAMRVYHKSVGEQAERLICPTDLCEHIMNMTYSRAVTDPALLN
RYKGWTAEVYGEFTSKMISDVIANSNVQPDDTFVDLGSGVGQVVLQVALEGRARTSFGIE
KQDIPAEYAKCGAYELVKDNFLQPQYAERITNTSVVFLNNFAFGTKVNQQLCRMFENCQA
GTRLISSISLRKSDFTITARTLNDLGCILTMRKLCYRGQGVSWTARPFSYYVQTVNHQYL
DQFFSKGEPVQVPFENEVGDDDDDANPDRTGTSHSGAPVRDNSDDEEDNDEEAEDQSAGA
AGHHKTDAVGKGHSGAERDGKAAAGTRPGSTKRSKGASRRRDRQSSQQSSAPPSSSSGKV
AAGDDSASQRLVRTLTRAVAGLERRYPSGRTLRAARHQLRALHQERSVLRQHRREYEQQL
QQHNQTVAAALTQRRQQLNESLGLDSKTDTRLTAAAAGLLHTFVCRGGQSATSSAANAQQ
SVEHIRLWTKPLQQAQAVHERLIAALRMHGQAPVADALQRTPWALPRDLCASNEHSPTRA
TNGHVPVQEASAGKAGPTGPHQSARRSSDQNGSASSQVQSAQTRGLEATPDRYAGPLSSA
ETSPASTSSHSAGKRDLSGQREATNGTEHTSQAQIAGRRESSSTGTSPTSSLAKLLGAEP
SHRSGHRQGQQRPIARAREMRPPGGARPGLSSSSKRPLSSNGEPAPQVPDPKRTKDLENA
SSDNALERKQKCHGPETSN

BLAST