GenomeNet

>mbr:MONBRDRAFT_34875 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) hypothetical protein (A)
MERHFHSEQSRSQLAGPAAGLAGYPKFDESSHSLLKKHLTKDAYLQCETRVTPSGFTLQH
AIQSGVDNQDSGVGLYAGDEESYTVFAPVFDAVIEDYHNGYKPTDRHVSDMDASKLRGVP
DPEGDYVISTRIRVGRNIKGLGLSPGISRANRRKVEELVVEALNQLEGDLAGTYYSLGSM
SEADRKQLVADHFLFKKGDRFLQSAGANRDWPESRGIFHNNEKTFLVWVNEEDQMRIISM
QKGSDAKEIFERLSRGISAVEEKIKAAGFEFAHNEHLGFIHSCPTNCGTGMRASVHVKLP
KVGAHPDFKKWCEKLRLQPRGIHGEHSESDGGVYDLSNKERLGKSEVELVQTMIDGVQVL
IAAEKALVAGEPLPKELTE

BLAST