GenomeNet

>mbr:MONBRDRAFT_8499 hypothetical protein; K01785 aldose 1-epimerase [EC:5.1.3.3] (A)
MAQVEKAEYGKLSETGETVHIYTLTGAQGLVVKIMDYGATIVSLLAPDESGAKADVVLGF
ATLADWETKNVPYFGAVIGRVANRIAKGEMEVDGKTYTLAINNGPNHLHGGLRGFDKQVW
QSEIVENGVRFSLISPDGQENYPGECKVQVTYTVSEDNKLTLSYEFEVDKRCPVNITNHA
YFNLAGAASGSVRDHKLTMPSTHVTEAIELIPTGKLLPVEIERGYDVNFVVQREDDSGLC
LAAEYVSAAMSPFTSMPVFCFVWAFRLRLRDNPHMECGRGIAWLIPNRDVACGASRLPYN
PYQAFCLETQHFPDSVHRPEFPTVLREAGRKYTSQTVYEFYATSSDATSAKKAKTRTSLS
QERRTLCLLFSGHQGVPCQLSYLQRKPVTGVYLKPTDDERTGQCMSAKAG

BLAST