GenomeNet

>mbr:MONBRDRAFT_8499 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) hypothetical protein (A)
MAQVEKAEYGKLSETGETVHIYTLTGAQGLVVKIMDYGATIVSLLAPDESGAKADVVLGF
ATLADWETKNVPYFGAVIGRVANRIAKGEMEVDGKTYTLAINNGPNHLHGGLRGFDKQVW
QSEIVENGVRFSLISPDGQENYPGECKVQVTYTVSEDNKLTLSYEFEVDKRCPVNITNHA
YFNLAGAASGSVRDHKLTMPSTHVTEAIELIPTGKLLPVEIERGYDVNFVVQREDDSGLC
LAAEYVSAAMSPFTSMPVFCFVWAFRLRLRDNPHMECGRGIAWLIPNRDVACGASRLPYN
PYQAFCLETQHFPDSVHRPEFPTVLREAGRKYTSQTVYEFYATSSDATSAKKAKTRTSLS
QERRTLCLLFSGHQGVPCQLSYLQRKPVTGVYLKPTDDERTGQCMSAKAG

BLAST