GenomeNet

>mbu:Mbur_0436 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) Glycoside hydrolase family 57 protein (A)
MQSVCICSEVHLPCVLKWYWPSEGYRSPEFETYFDQSKMYSALEKNVPGIIRTNEALLDS
IDNGAKYTFDISGIFLDQCKWNPAVIESFKELKDRGAGFSASPYYHSISSLFPDTKEFKE
QVSMHRDKIKEIFNVNPRTFINTELILTKELSAILKEMKFKCLISEGSENLLYGNDPNQV
YDNHIPTLLRHIPLSEDIEIRFSDQKWISYPLIADKFASWIANMEGDVTTLHFKYSSILS
HQHNRSDILQFLIDLPASFEKYGISMITPEEALKNFKTKELPSIMNKSTSRYGMHNLMGN
HPQHLYLHELISIGEILQSIKSAPEYDKLNCIYRYLQQSEILLEMGSDNQNIGYEKAVNI
FSALSDFKRAILEVKV

BLAST