GenomeNet

>mbu:Mbur_1758 protein with ATP dependent DNA ligase domain; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MGFPKIHRAMLLKPAIEAHFSDVETVCVEEKMNGFNVRIVTVDGKIIAITRGGYVCPYST
ERAQKFLNIDFFEEHPELVLHGEMVGPDNPYIPKKIYNVESLELFVFDIRHKHSGIPLPL
HERRQLAEEYGFTQVRLFGEFPKEEAPLRISEIIRELGKIEHEGVIIKDPMMEIAPLKYT
CSQSNCADLKHAFKFYNDAGRDYLFSRVVREGFQAVEWEETGDDIDKRCLQLGRSILYPM
IDSIVNIGNGVRLADEVQMRLSNLETVSKFKEYLRRQGIDAIFSEPEVVGDEFIVKIKKL
NKSTNDKTLSMWKGETW

BLAST