GenomeNet

>mbu:Mbur_1758 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) protein with ATP dependent DNA ligase domain (A)
MGFPKIHRAMLLKPAIEAHFSDVETVCVEEKMNGFNVRIVTVDGKIIAITRGGYVCPYST
ERAQKFLNIDFFEEHPELVLHGEMVGPDNPYIPKKIYNVESLELFVFDIRHKHSGIPLPL
HERRQLAEEYGFTQVRLFGEFPKEEAPLRISEIIRELGKIEHEGVIIKDPMMEIAPLKYT
CSQSNCADLKHAFKFYNDAGRDYLFSRVVREGFQAVEWEETGDDIDKRCLQLGRSILYPM
IDSIVNIGNGVRLADEVQMRLSNLETVSKFKEYLRRQGIDAIFSEPEVVGDEFIVKIKKL
NKSTNDKTLSMWKGETW

BLAST