GenomeNet

>mca:MCA2743 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL; ribulose bisphosphate carboxylase, large subunit (A)
MAVKTYNAGVKEYRETYWDPNYTPADTDLLAVFKITPQPGVPREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGQDEQFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRGLRLEDVRFPLAYVMTCGGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRQRFDFVMEAIEKAEAETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDFITGGFCANTGLANWCRNNGMLLHIHRAMHAVMDRNPNH
GIHFRVFTKMLRLSGGDHLHTGTVVGKLEGDRQATLGWIDLLRERSIKEDRSRGIFFDQE
WGAMPGVFAVASGGIHVWHMPALLSIFGDDAVFQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNEGRQLEKEGKEILTEAAKSSPELKAAMETWKEIKFEFDTVDKLDVAHR

BLAST