GenomeNet

>mca:MCA2744 cbbS; ribulose bisphosphate carboxylase, small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MSDMQDYKSSLSDSGSRKFETFSYLPPMNPEKIRRQVEYIVSRGWNPAIEHTEPENAFDH
YWYMWKLPMFGETDVDAILAEAEACHKAHPNNHVRLVGYDNFRQTQGAAMVIYRGPSV

BLAST