GenomeNet

>mcb:Mycch_2784 heme peroxidase family protein (A)
MTGGFWRRNGVKNGVRIYATTHFEWFWRTLARTPKVRSRVNKWIINRSIYTMATRPAPLS
TRSDYTSWESLHDRAYSLRHLPANPALQIGQPPVDRVAELFRRPTPRSAPSDRSTLLFPL
FAQWFVDGFLRTDPTCPLKNTSTHDIDLSQLYGQTEDVTSMLREGSGGRLLSQVIDGQEF
PPYYFGADGRVDPRFEGLQIAYPGNDRKTLALGDIPVEKRQKLFALGIPRGNIHYGFVMM
STLFLREHNRLAALIRANHPTWDDDRIFDTTRNTLIVMLIKVVIEDYINHITPIKFPLFV
EPGIGLYEKWYRQNWMSVEFNLLYRWHSLVPTEVRVGGRDVMFSDVGWDTRIVTDHGLAA
LFHEASDQPCSTISLLNTDASLLDIEKTSIAIGRDAELDSYNAYRQRCGFPRLHSFRALT
SDRTLRKALADCYGKRGIDDLELFVGLFGEDVGKGATLPTLMTAMVAVDAFSQALTNPLL
APGIYGKDTFSYAGLDEIDGTRTLQDIVRRNVPGEEFVPRVSLGVKN

BLAST