GenomeNet

>mcc:696445 K15791 probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 [EC:1.2.4.2] | (RefSeq) DHTKD1; dehydrogenase E1 and transketolase domain containing 1 (A)
MASATVAAARRGLGRAPPLIWRGYQTERGVYGYRPRKPESREPRGALERPPVDHGLARLV
TVYREHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMEKEEASLEEVLV
YLNQIYCGQISIETSQLQSQEEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFL
ATKFSTVKRYGGEGAESMMGFFHELLKMSAYSGITDVIIGMPHRGRLNLLTGLLQFPPEL
MFRKMQGLSEFPENFSATGDVLSHLTSSVDLDFGAHHPLHVTMLPNPSHLEAVNPVAVGK
TRGRQQSRQDGDYSPDNSAQPGDRVICLQVHGDASFCGQGIVPETFTLSSLPHFRIGGSV
HLIVNNQLGYTTPAERGRSSLYCSDIGKLVGCAIVHVNGDSPEEVVRATRLAFEYQRQFR
KDVIIDLLCYRQWGHNELDEPFFTNPIMYKIIRARKSIPDTYAEHLIASGLMTQEEVSEI
KSSYYAKLNDHLNNMAHYSPPALNLQAHWQGLAQPEARITTWSTGVPLDLLQFVGVKSVE
VPRELQMHSHLLKTHVQSRMEKMMDGTKLDWATAEALALGSLLAQGFNVRLSGQDVGRGT
FSQRHAMVVCQETDDTYIPLNHMDPNQKGFLEVSNSPLSEEAVLGFEYGMSIESPKLLPL
WEAQFGDFFNGAQIIFDTFISGGEAKWLLQSGLVILLPHGYDGAGPDHSSCRIERFLQMC
DSVEEGVDGDTVNMFVVHPTTPAQYFHLLRRQMVRNFRKPLIVASPKMLLRLPAAVSTLQ
EMAPGTTFNPVIGDSSVDPEKVKTLVFCSGKHYYSLLKQRESLGPKRHDFAIIRVEELCP
FPLDSLQQEMSKYKHVKDHIWSQEEPQNMGPWSFVSPRFEKQLACKLRLVGRPPLPVPAV
GIGTVHLHQHEDILSKTFA

BLAST