GenomeNet

>mcc:703880 SETMAR; SET domain and mariner transposase fusion gene; K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MFAEAAKKTGPCGMAEFKKKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVG
PGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNV
LCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQR
RIHLQTKSDSNYIIAIREHVYTGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSM
VPKLALFAAKDIVPEEELSYDYSGRYLNLTGSEDKERLDNGKLRKPCYCGAKSCTAFLPF
DGSLYCPLEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFK
MGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLI
LRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEAAPKHFSKPILHPKKIMVTIWWSAA
GVIHYSFLNPGETITSEKYAQEIDEMHQKLQHLQLALVNRKGPILLHDNARPHVAQPTLQ
KLNELGYEVLPHPPYSPDLLPTNYHIFKHLNNFLQGKRFHNQQDAENAFQEFVKSRSTDF
YATGINQLISRWQKCVDCNGAYFD

BLAST