GenomeNet

>mcc:706009 K04527 insulin receptor [EC:2.7.10.1] | (RefSeq) INSR, IR; insulin receptor (A)
MNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAE
LEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWD
WSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELL
KFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD
IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDAT
NPSVPLDPTQCLTHIPDYSEVETAFGDPNGKHPPLPGFLGEGSGRHGSSHPFPYVSVYVW
CVCGACVWMCARVCVFSRRDVSPAFLFLSPGLKLPSRTWSPPFESEDSQKHNQSEYEDSA
GECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGD
VGNVTVAVPTVAAFPNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACN
QDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYEV
SYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTD
YLDVPSNIAKIIIGPLIFVFLFSIVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVF
PCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLR
ERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNP
GRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYE
TDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVL
KFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHS
EENKAPENEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNG
GKKNGRILTLPRSNPS

BLAST