GenomeNet

>mcc:706277 SETDB2; SET domain, bifurcated 2; K18494 histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43] (A)
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSVKGASQKEVNTQSTEHMPVTQKEQENKSNAFPSTSYGNSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSLNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEV
VSDVDISNGVESMPISFCNEIDSRKLPKFKYRKTVWPRTYYLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSNGTDENGKDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKIEKCPPKFSNNPKELTMETKYDNT
SRIRYHSVIGDPESKTAIFQHNGKKMEFVASESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDDFEDNLLTESDVIDITKCREETPPRSRCNQATTLDNQNIKKAVEVQIQKPQEGR
STACQKQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL

BLAST