GenomeNet

>mcc:707908 ADH1B; alcohol dehydrogenase 1B (class I), beta polypeptide (EC:1.1.1.1); K13951 alcohol dehydrogenase 1/7 [EC:1.1.1.1] (A)
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVS
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKSPEGNYCVKNDLSNP
RGTLQDGTRRFTCRGKPIHHFVGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSVCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAVYGGFKSREGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLRSGKSIRTVLTF

BLAST