GenomeNet

>mcc:708018 SDHA; succinate dehydrogenase complex subunit A, flavoprotein (Fp); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSPTTAPLDPGVVRRRDIPLARPRRGAQAQSAQGLAGLRGGVNSHVGGPETVAAAEHSAP
GAGQGGQSVPRTGAGQAGAEAAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTMKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGD
KVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKI
SKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVTLEYRPVIDKTLNEADCATVPP
AIRSY

BLAST