GenomeNet

>mci:Mesci_1361 xylose isomerase domain-containing protein; K01805 xylose isomerase [EC:5.3.1.5] (A)
MTATRFATRLNSFASRPQAEWPDLTGKPSLLQMAARAAKVGGLTDLDLNFPDHVSEKPAE
IALKLSDLGLSINGFAMRYYSNPAFKLGAFTNPDPAVRREAIDLTKAGIDALREAGASLM
TLWLGQDGFDYAFQADYATLWQHEIDGIREVSAHDPDCQISLEYKPNEPRSYSLMPDAAT
TLLAIRDVGVPNLGVTLDFAHVLYADEQPAFAAALVARHSKLLGVHLNDGYAKRDDGLMV
GAVHTLQTIELLRQIRRDGYAGAIYFDTFPDMTGLDPVRECEVNIATVKRMLRVVDRLEQ
DNRLSAAMDSQDAVTSQAIIQEIMLGPDS

BLAST