GenomeNet

>mci:Mesci_1361 K01805 xylose isomerase [EC:5.3.1.5] | (RefSeq) xylose isomerase domain-containing protein (A)
MTATRFATRLNSFASRPQAEWPDLTGKPSLLQMAARAAKVGGLTDLDLNFPDHVSEKPAE
IALKLSDLGLSINGFAMRYYSNPAFKLGAFTNPDPAVRREAIDLTKAGIDALREAGASLM
TLWLGQDGFDYAFQADYATLWQHEIDGIREVSAHDPDCQISLEYKPNEPRSYSLMPDAAT
TLLAIRDVGVPNLGVTLDFAHVLYADEQPAFAAALVARHSKLLGVHLNDGYAKRDDGLMV
GAVHTLQTIELLRQIRRDGYAGAIYFDTFPDMTGLDPVRECEVNIATVKRMLRVVDRLEQ
DNRLSAAMDSQDAVTSQAIIQEIMLGPDS

BLAST