GenomeNet

>mci:Mesci_2116 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFHYATMNAGKTTMLLQASYNYRERGMGTMLFVAGHYRKGDTGLISSRIGLETEAE
MFRDGDDLFARVAAHHAHTSVHCVFVDEAQFLEEEQVWQLARIADRLNIPVMCYGLRTDF
QGKLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGPDGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAAPDDFIGFIKG

BLAST