GenomeNet

>mci:Mesci_4908 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) manganese/iron superoxide dismutase-like protein (A)
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLELYEKAK

BLAST