GenomeNet

>mcj:MCON_0453 no KO assigned | (GenBank) conserved hypothetical protein (A)
MNPDALKSYQEKRNFAVTSEPNPPKIADKRANSGSQIFVVQEHHSRQLHYDFRLEVDGVL
KSWAVPKGPSMNPKDKRLAVQTEDHPIEYASFEGTIPEGEYGAGTVAIWDRGIYQNLSNK
DGQEISLSQALKGGHASFWLKGKRLQGGFALTRTPRGWLLVKMRDEKAES

BLAST