GenomeNet

>mcj:MCON_0453 hypothetical protein (A)
MNPDALKSYQEKRNFAVTSEPNPPKIADKRANSGSQIFVVQEHHSRQLHYDFRLEVDGVL
KSWAVPKGPSMNPKDKRLAVQTEDHPIEYASFEGTIPEGEYGAGTVAIWDRGIYQNLSNK
DGQEISLSQALKGGHASFWLKGKRLQGGFALTRTPRGWLLVKMRDEKAES

BLAST