GenomeNet

>mcj:MCON_2015 conserved hypothetical protein TIGR01209; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MNLQRIADKLGITVDRLQSLQDTKISESSWPEPQLLRFDKEISGVEAGTVIFKNGEIVWG
YPSIRRPLMLEAGIKRHFIDSVAVEEKMNGHNVRITSIDGDIVALTRGGFVCPYSTEVAT
RLLPEDIFEEKPNLVLCAEMVGPENPYVSLDVYPTDSIDLYLFDVAQKNQRGTHGVHKTH
EIAEDFGLKGTAFFGEFPRETAHKRIKEIVIKLGRQGREGVVLKDPENRVAPLKYTSSES
NCNDLAIAFSHYNDYALDFFLSRAVREGFQSVEWQESVEERRERARRIGESILLPLTETI
KNKQQGETIMQRIKIRVKSLATARGFEYHLRRCGIRAIFDQPLPDDDGYTIGITKIIMST
NDKTEALLNGEMW

BLAST