GenomeNet

>mcu:HMPREF0573_10118 BNR/Asp-box repeat protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MQRTVVAPHASAGFMQARYPAIARTSSRVLLMIWEALPSECAASARMEQAKAKSASLEEP
HYRRLCPTSLRLSRSFDNGLTWEEPRTLAAGNPQEFFGFHVPSFLHDCVTGRMFCFYTRS
LVPDWDLRQAQTALFVAWTDDDGLSWEHQDITSMIIAGRDFSMAYIPRGRGTQLTSGQWA
QRLCHAGVIVDESGDRKAVFIGSDDHGASWWASSPVGANVDYCTAVSNSDGTEVMLLMKT
QGSTVKTWAKSADAGRTFGQPAAATDSRLINIMSPLEEVFHGACPGTPHADVFSYIGERT
TDQGDCTVLMLSTDGAKSFREAEMFDVQTYGALDIVSMADQAKFAIAFEGADGVVCEVLP
FSKLGNIDALAEQWVHQA

BLAST