GenomeNet

>mcu:HMPREF0573_11199 glpA; anaerobic glycerol-3-phosphate dehydrogenase subunit A (EC:1.1.5.3); K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MSSVTRLHADLVVIGGGATGAGVARDAAMRGYDVILLERADIGQGTSARYHGLLHSGGRY
VISDPESATQCADENAILRRINADALEDVGGMFVLTPDDPEDYADRFLPAALKAGVTCEE
IPLSTAFKMEPRLNPQIKRAFRVNDGAVDGWKLIWGALESAKEYGAKILPYHRVQAIVVK
DGAVCAVSARNEKTGAEVHVDCGFIINAAGPWAGQIAKLAGADNIEIIPGRGIMIGFNQR
LVHHVINRCALSGDGDILVPAHPICIIGTTDQPAAKPDFLDIKPEEVQQMLDKGEQLVPG
LRQARALHVWAGARPLLRDSRVSASDTRHMTRGMAILDHQERDGIRGFLTIAGGKLTTYR
LMAEKVVNIMCHQLGDNRVCTTAQEPVPSAQARRFSRLSDRLQARETDRHDDPIICECEL
VNQRMILETLAENPLANIDDLRRHLRIGMGPCQGSFCGARTAGIIHDFRLQNLPTPPASA
VVAPPDSPTSNTVTPTATDCPAALRADVSTTMLNLFLSNRLGGITPILYGALAREMALQR
WIMGTLDLEHLPGPTPESSRATGDLALNHGTGHTEPTGGAR

BLAST