GenomeNet

>mcv:BN43_60050 ligB; Putative ATP-dependent DNA ligase LigB (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (Sealase) (DNA repair protein) (DNA joinase) (EC:6.5.1.1); K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] (A)
MLLHDVAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGVALDTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFF
DILHRDGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMA
KAPAARYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVM
VGKTFKGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLAL
RFARVVRYRADKDPAEADTIDAVRALY

BLAST