GenomeNet

>mcv:BN43_90239 Conserved protein of unknown function (A)
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK

BLAST